Skip to product information
1 of 1

Gene Bio Systems

Recombinant Glycine max Bowman-Birk type proteinase inhibitor D-II

Recombinant Glycine max Bowman-Birk type proteinase inhibitor D-II

SKU:CSB-EP360616GGV

Regular price €1.023,95 EUR
Regular price Sale price €1.023,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 10-20 working days

Research Topic: Others

Uniprot ID: P01064

Gene Names: N/A

Organism: Glycine max (Soybean) (Glycine hispida)

AA Sequence: SDQSSSYDDDEYSKPCCDLCMCTRSMPPQCSCEDIRLNSCHSDCKSCMCTRSQPGQCRCLDTNDFCYKPCKSRDD

Expression Region: 9-83aa

Sequence Info: Full Length

Source: E.coli

Tag Info: N-terminal 6xHis-SUMO-tagged

MW: 24.5 kDa

Alternative Name(s): IV

Relevance:

Reference: "Studies on soybean trypsin inhibitors, XII. Linear sequences of two soybean double-headed trypsin inhibitors, D-II and E-I."Odani S., Ikenaka T.J. Biochem. 83:737-745(1978)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

View full details