Skip to product information
1 of 1

Gene Bio Systems

Recombinant Glycerol dehydrogenase small subunit(sldB)

Recombinant Glycerol dehydrogenase small subunit(sldB)

SKU:CSB-CF811844GDAB

Regular price €1.407,95 EUR
Regular price Sale price €1.407,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Gluconobacter thailandicus

Uniprot NO.:Q8L1D5

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:PNLQGNRTLTEWLTLLLGVIVLLVGLFFVIGGADLAMLGGSTYYVLCGILLVASGVFMLM GRTLGAFLYLGALAYTWVWSFWEVGFSPIDLLPRAFGPTILGILVALTIPVLRRMESRRT LRGAV

Protein Names:Recommended name: Glycerol dehydrogenase small subunit EC= 1.1.99.22 Alternative name(s): D-arabitol dehydrogenase small subunit Short name= ARDH D-sorbitol dehydrogenase subunit sldB Short name= SLDH Gluconate/polyol

Gene Names:Name:sldB

Expression Region:2-126

Sequence Info:full length protein

View full details