Gene Bio Systems
Recombinant Gluconacetobacter diazotrophicus UPF0060 membrane protein GDI3492-Gdia_2889 (GDI3492, Gdia_2889)
Recombinant Gluconacetobacter diazotrophicus UPF0060 membrane protein GDI3492-Gdia_2889 (GDI3492, Gdia_2889)
SKU:CSB-CF433593GEN
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Gluconacetobacter diazotrophicus (strain ATCC 49037 / DSM 5601 / PAl5)
Uniprot NO.:A9H4G8
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MRMLLGSFAVYAAAALCEIGGCYAWWCWRRAGAGAWVLLPGMASLALFGWLLTLVDSDTA GRTFAAYGGIYIVGAIVWLRLVEGRPVTLRDAAGVAICLAGAAIILSAGRGAER
Protein Names:Recommended name: UPF0060 membrane protein GDI3492/Gdia_2889
Gene Names:Ordered Locus Names:GDI3492, Gdia_2889
Expression Region:1-114
Sequence Info:full length protein
