Skip to product information
1 of 1

Gene Bio Systems

Recombinant Gibberella zeae Protein SYM1(SYM1)

Recombinant Gibberella zeae Protein SYM1(SYM1)

SKU:CSB-CF675735GGB

Regular price €1.457,95 EUR
Regular price Sale price €1.457,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) (Wheat head blight fungus) (Fusarium graminearum)

Uniprot NO.:Q4IPX8

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MSSFIRWYNSRLAARPLLTQSVTTAFLFATGDVTAQQLVEKRGAQKHDLVRTGRMALYGG FVFGPVATTWFAFLARRVNVRNNKKAEVLARVACDQLGFAPVMIGVFLSSMATMEGKSVK ERIDKTWWPALKANWMVWPAVQVINFSLIPLQYRLFFANIIAIGWNSYLSWVNSQ

Protein Names:Recommended name: Protein SYM1

Gene Names:Name:SYM1 ORF Names:FG00730

Expression Region:1-175

Sequence Info:full length protein

View full details