Skip to product information
1 of 1

Gene Bio Systems

Recombinant Gibberella zeae Plasma membrane proteolipid 3(PMP3)

Recombinant Gibberella zeae Plasma membrane proteolipid 3(PMP3)

SKU:CSB-CF677960GGB

Regular price €1.200,95 EUR
Regular price Sale price €1.200,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) (Wheat head blight fungus) (Fusarium graminearum)

Uniprot NO.:Q4HXT6

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MPFTASITAYTNIFFSDICKIILAIILPPVGVFLERGCGADFFINILLTILGYIPGIIHA LYIILKY

Protein Names:Recommended name: Plasma membrane proteolipid 3

Gene Names:Name:PMP3 ORF Names:FG10222

Expression Region:1-67

Sequence Info:full length protein

View full details