Skip to product information
1 of 1

Gene Bio Systems

Recombinant Fusobacterium nucleatum subsp. nucleatum UPF0059 membrane protein FN1615(FN1615)

Recombinant Fusobacterium nucleatum subsp. nucleatum UPF0059 membrane protein FN1615(FN1615)

SKU:CSB-CF854613FDQ

Regular price €1.459,95 EUR
Regular price Sale price €1.459,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / CIP 101130 / JCM 8532 / LMG 13131)

Uniprot NO.:Q8RII2

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MSTISVLITALALSMDAMSLSIYQGIASTESQKKQNFLKIVLTFGIFQFAMALVGSLSGI LFIHYISLYSKYVSFAIFLFLGLMMLKEALKKEEMEYDEKYLDFKTLIIMGIATSLDALL VGLTFSILPFYQTFLYTVEIGVITAIIAGLGFILGDKFGNILGQKSHFLGAALLIFISIN ILL

Protein Names:Recommended name: UPF0059 membrane protein FN1615

Gene Names:Ordered Locus Names:FN1615

Expression Region:1-183

Sequence Info:full length protein

View full details