Gene Bio Systems
Recombinant Fucoxanthin-chlorophyll a-c binding protein E, chloroplastic(FCPE)
Recombinant Fucoxanthin-chlorophyll a-c binding protein E, chloroplastic(FCPE)
SKU:CSB-CF669219PAAY
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Phaeodactylum tricornutum
Uniprot NO.:Q41093
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:AFENELGAQPPLGFFDPLGLVADGDQEKFDRLRYVEIKHGRISMLAVAGYLVQENGIRLP GDIDYSGTSFESIPNGFAALTTISGAGIAQIVAFIGFLELAVMKDITGGEFVGDFRNDFI DFGWDSFDEETKMQKRAIELNQGRAAQMGILALMVHEQLGVSLIPN
Protein Names:Recommended name: Fucoxanthin-chlorophyll a-c binding protein E, chloroplastic
Gene Names:Name:FCPE Synonyms:FPC3
Expression Region:32-197
Sequence Info:full length protein