Skip to product information
1 of 1

Gene Bio Systems

Recombinant Fluoroquinolones export permease protein Rv2687c-MT2761 (Rv2687c, MT2761)

Recombinant Fluoroquinolones export permease protein Rv2687c-MT2761 (Rv2687c, MT2761)

SKU:CSB-CF517436MVZ

Regular price €1.513,95 EUR
Regular price Sale price €1.513,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Mycobacterium tuberculosis

Uniprot NO.:O07189

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MTRLVPALRLELTLQVRQKFLHAAVFSGLIWLAVLLPMPVSLRPVAEPYVLVGDIAIIGF FFVGGTVFFEKQERTIGAIVSTPLRFWEYLAAKLTVLLAISLFVAVVVATIVHGLGYHLL PLVAGIVLGTLLMLLVGFSSSLPFASVTDWFLAAVIPLAIMLAPPVVHYSGLWPNPVLYL IPTQGPLLLLGAAFDQVSLAPWQVGYAVVYPIVCAAGLCRAAKALFGRYVVQRSGVL

Protein Names:Recommended name: Fluoroquinolones export permease protein Rv2687c/MT2761

Gene Names:Ordered Locus Names:Rv2687c, MT2761

Expression Region:1-237

Sequence Info:full length protein

View full details