Skip to product information
1 of 1

Gene Bio Systems

Recombinant Flavobacterium johnsoniae Aquaporin Z(aqpZ)

Recombinant Flavobacterium johnsoniae Aquaporin Z(aqpZ)

SKU:CSB-CF773691FAAX

Regular price €1.360,95 EUR
Regular price Sale price €1.360,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Flavobacterium johnsoniae (Cytophaga johnsonae)

Uniprot NO.:Q7WVD3

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MKKLFAEFFGTYWLVFGGCGSAVFAAGYPTLGIGFAGVALAFGLTVLTMAYAVGHISGGH FNPAVSFGLWAGGRFSAKD

Protein Names:Recommended name: Aquaporin Z

Gene Names:Name:aqpZ Synonyms:fjo22

Expression Region:1-79

Sequence Info:full length protein

View full details