Recombinant Felis catus (Cat) (Felis silvestris catus) Amyloid protein A(SAA1),partial

Recombinant Felis catus (Cat) (Felis silvestris catus) Amyloid protein A(SAA1),partial

CSB-EP020656CA
Regular price
€743,95 EUR
Sale price
€743,95 EUR
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

>Several Other Sizes Are Also Available. Please Inquire. Default Size: 200ug

Updated Date: Stock Protein updated on 20170405

Research areas: Others

Target / Protein: SAA1

Biologically active: Not Tested

Expression system: E.coli

Species of origin: Felis catus (Cat) (Felis silvestris catus)

Delivery time: 3-7 business days

Uniprot ID: P19707

AA Sequence: EWYSFLGEAAQGAWDMWRAYSDMREANYIGADKYFHARGNYDAAQRGPGGAWAAKVISDARENSQRVTDFFRHGNSGHGAEDSKADQEWG

Tag info: N-terminal 6xHis-B2M-tagged

Expression Region: 1-90aa

Protein length: Partial

MW: 24.1 kDa

Alternative Name(s): Amyloid fibril protein AACurated

Relevance: Major acute phase reactant. Apolipoprotein of the HDL complex.

Reference: Initial sequence and comparative analysis of SAA cat genome.Pontius J.U., Mullikin J.C., Smith D.R., Lindblad-Toh K., Gnerre S., Clamp M., Chang J., Stephens R., Neelam B., Volfovsky N., Schaffer A.A., Agarwala R., Narfstrom K., Murphy W.J., Giger U., Roca A.L., Antunes A., Menotti-Raymond M. , Yuhki N., Pecon-Slattery J., Johnson W.E., Bourque G., Tesler G., O'Brien S.J.Genome Res. 17:1675-1689(2007)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Your list is ready to share