Gene Bio Systems
Recombinant Escherichia coli UPF0266 membrane protein yobD(yobD)
Recombinant Escherichia coli UPF0266 membrane protein yobD(yobD)
SKU:CSB-CF304656ENV
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Escherichia coli (strain K12)
Uniprot NO.:P67601
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MTITDLVLILFIAALLAFAIYDQFIMPRRNGPTLLAIPLLRRGRIDSVIFVGLIVILIYN NVTNHGALITTWLLSALALMGFYIFWIRVPKIIFKQKGFFFANVWIEYSRIKAMNLSEDG VLVMQLEQRRLLIRVRNIDDLEKIYKLLVSTQ
Protein Names:Recommended name: UPF0266 membrane protein yobD
Gene Names:Name:yobD Ordered Locus Names:b1820, JW1809
Expression Region:1-152
Sequence Info:full length protein
