Skip to product information
1 of 1

Gene Bio Systems

Recombinant Escherichia coli Signal peptidase I(lepB),partial

Recombinant Escherichia coli Signal peptidase I(lepB),partial

SKU:CSB-EP360447ENV

Regular price €1.022,95 EUR
Regular price Sale price €1.022,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 10-20 working days

Research Topic: Microbiology

Uniprot ID: P00803

Gene Names: lepB

Organism: Escherichia coli (strain K12)

AA Sequence: RSFIYEPFQIPSGSMMPTLLIGDFILVEKFAYGIKDPIYQKTLIETGHPKRGDIVVFKYPEDPKLDYIKRAVGLPGDKVTYDPVSKELTIQPGCSSGQACENALPVTYSNVEPSDFVQTFSRRNGGEATSGFFEVPKNETKENGIRLSERKETLGDVTHRILTVPIAQDQVGMYYQQPGQQLATWIVPPGQYFMMGDNRDNSADSRYWGFVPEANLVGRATAIWMSFDKQEGEWPTGLRLSRIGGIH

Expression Region: 78-324aa

Sequence Info: Partial

Source: E.coli

Tag Info: N-terminal 6xHis-SUMO-tagged

MW: 43.7 kDa

Alternative Name(s): Leader peptidase I

Relevance: Cleavage of hydrophobic, N-terminal signal or leader sequences from secreted and periplasmic proteins.

Reference: "Sequence of the leader peptidase gene of Escherichia coli and the orientation of leader peptidase in the bacterial envelope."Wolfe P.B., Wickner W., Goodman J.M.J. Biol. Chem. 258:12073-12080(1983)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

View full details