Gene Bio Systems
Recombinant Escherichia coli Regulatory protein mokC(mokC)
Recombinant Escherichia coli Regulatory protein mokC(mokC)
SKU:CSB-CF339333ENV
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Escherichia coli (strain K12)
Uniprot NO.:P33236
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MLNTCRVPLTDRKVKEKRAMKQHKAMIVALIVICITAVVAALVTRKDLCEVHIRTGQTEV AVFTAYESE
Protein Names:Recommended name: Regulatory protein mokC
Gene Names:Name:mokC Synonyms:gefL Ordered Locus Names:b0018, JW5879
Expression Region:1-69
Sequence Info:full length protein
