Gene Bio Systems
Recombinant Escherichia coli Putative general secretion pathway protein B(gspB)
Recombinant Escherichia coli Putative general secretion pathway protein B(gspB)
SKU:CSB-CF366056ENV
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Escherichia coli (strain K12)
Uniprot NO.:P03825
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MFEFYIAAREQKETGHPGIFSRQKHSTIIYVICLLLICLWFAGMVLVGGYARQLWVLWIV KAEVTVEAETPAFKQSTQHYFFKKQPLPVVESVEEEDDPGVAVENAPSSSEDEENTVEES EEKAGLRERVKNALNELER
Protein Names:Recommended name: Putative general secretion pathway protein B Alternative name(s): Protein PinO Protein PioO
Gene Names:Name:gspB Synonyms:pinO, pioO, pno Ordered Locus Names:b3322, JW3284
Expression Region:1-139
Sequence Info:full length protein
