Skip to product information
1 of 1

Gene Bio Systems

Recombinant Escherichia coli Protein hdeD(hdeD)

Recombinant Escherichia coli Protein hdeD(hdeD)

SKU:CSB-CF365195ENV

Regular price €1.467,95 EUR
Regular price Sale price €1.467,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Escherichia coli (strain K12)

Uniprot NO.:P0AET5

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MLYIDKATILKFDLEMLKKHRRAIQFIAVLLFIVGLLCISFPFVSGDILSTVVGALLICS GIALIVGLFSNRSHNFWPVLSGFLVAVAYLLIGYFFIRAPELGIFAIAAFIAGLFCVAGV IRLMSWYRQRSMKGSWLQLVIGVLDIVIAWIFLGATPMVSVTLVSTLVGIELIFSAASLF SFASLFVKQQ

Protein Names:Recommended name: Protein hdeD

Gene Names:Name:hdeD Synonyms:yhiA Ordered Locus Names:b3511, JW3479

Expression Region:1-190

Sequence Info:full length protein

View full details