Skip to product information
1 of 1

Gene Bio Systems

Recombinant Escherichia coli Phosphatidylglycerophosphatase A(pgpA)

Recombinant Escherichia coli Phosphatidylglycerophosphatase A(pgpA)

SKU:CSB-CF324695ENV

Regular price €1.460,95 EUR
Regular price Sale price €1.460,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Escherichia coli (strain K12)

Uniprot NO.:P18200

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MTILPRHKDVAKSRLKMSNPWHLLAVGFGSGLSPIVPGTMGSLAAIPFWYLMTFLPWQLY SLVVMLGICIGVYLCHQTAKDMGVHDHGSIVWDEFIGMWITLMALPTNDWQWVAAGFVIF RILDMWKPWPIRWFDRNVHGGMGIMIDDIVAGVISAGILYFIGHHWPLGILS

Protein Names:Recommended name: Phosphatidylglycerophosphatase A EC= 3.1.3.27

Gene Names:Name:pgpA Synonyms:yajN Ordered Locus Names:b0418, JW0408

Expression Region:1-172

Sequence Info:full length protein

View full details