Recombinant Escherichia coli Outer membrane protein C(ompC)

Customer Reviews

Be the first to write a review
0%
(0)
0%
(0)
0%
(0)
0%
(0)
0%
(0)

Recombinant Escherichia coli Outer membrane protein C(ompC)

CSB-EP356994ENV
Regular price
€750,95 EUR
Sale price
€750,95 EUR
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.
 More payment options

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: Yes

Lead time: 3-7 working days

Research Topic: Others

Uniprot ID: P06996

Gene Names: ompC

Organism: Escherichia coli (strain K12)

AA Sequence: AEVYNKDGNKLDLYGKVDGLHYFSDNKDVDGDQTYMRLGFKGETQVTDQLTGYGQWEYQIQGNSAENENNSWTRVAFAGLKFQDVGSFDYGRNYGVVYDVTSWTDVLPEFGGDTYGSDNFMQQRGNGFATYRNTDFFGLVDGLNFAVQYQGKNGNPSGEGFTSGVTNNGRDALRQNGDGVGGSITYDYEGFGIGGAISSSKRTDAQNTAAYIGNGDRAETYTGGLKYDANNIYLAAQYTQTYNATRVGSLGWANKAQNFEAVAQYQFDFGLRPSLAYLQSKGKNLGRGYDDEDILKYVDVGATYYFNKNMSTYVDYKINLLDDNQFTRDAGINTDNIVALGLVYQF

Expression Region: 22-367aa

Sequence Info: Full Length

Source: E.coli

Tag Info: N-terminal 6xHis-SUMO-tagged

MW: 54.3 kDa

Alternative Name(s): Outer membrane protein 1BPorin OmpC

Relevance: Forms pores that allow passive diffusion of small molecules across the outer mbrane.

Reference: Crystal structure of osmoporin OmpC from E. coli at 2.0 A.Basle A., Rummel G., Storici P., Rosenbusch J.P., Schirmer T.J. Mol. Biol. 362:933-942(2006)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

You may also like

  • Recombinant Escherichia coli Outer membrane protein C(ompC)
    Regular price
    €829,95 EUR
    Sale price
    €829,95 EUR
    Regular price
    Unit price
    per 
    Sold out
  • Recombinant Escherichia coli Outer membrane protein C(ompC)
    Regular price
    €750,95 EUR
    Sale price
    €750,95 EUR
    Regular price
    Unit price
    per 
    Sold out
  • Recombinant Escherichia coli Outer membrane protein C (ompC)
    Regular price
    €750,95 EUR
    Sale price
    €750,95 EUR
    Regular price
    Unit price
    per 
    Sold out
  • Recombinant Escherichia coli Outer membrane protein C (ompC)
    Regular price
    €638,95 EUR
    Sale price
    €638,95 EUR
    Regular price
    Unit price
    per 
    Sold out

Your list is ready to share