Gene Bio Systems
Recombinant Escherichia coli O9:H4 UPF0114 protein YqhA(yqhA)
Recombinant Escherichia coli O9:H4 UPF0114 protein YqhA(yqhA)
SKU:CSB-CF419620EJF
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Escherichia coli O9:H4 (strain HS)
Uniprot NO.:A8A4G1
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MERFLENAMYASRWLLAPVYFGLSLALVALALKFFQEIIHVLPNIFSMAESDLILVLLSL VDMTLVGGLLVMVMFSGYENFVSQLDISENKEKLNWLGKMDATSLKNKVAASIVAISSIH LLRVFMDAKNVPDNKLMWYVIIHLTFVLSAFVMGYLDRLTRHNH
Protein Names:Recommended name: UPF0114 protein YqhA
Gene Names:Name:yqhA Ordered Locus Names:EcHS_A3181
Expression Region:1-164
Sequence Info:full length protein
