Skip to product information
1 of 1

Gene Bio Systems

Recombinant Escherichia coli O8 UPF0059 membrane protein yebN(yebN)

Recombinant Escherichia coli O8 UPF0059 membrane protein yebN(yebN)

SKU:CSB-CF482537EOO

Regular price €1.471,95 EUR
Regular price Sale price €1.471,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Escherichia coli O8 (strain IAI1)

Uniprot NO.:B7M296

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MNITATVLLAFGMSMDAFAASIGKGATLHKPKFSEALRTGLIFGAVETLTPLIGWGMGML ASRFVLEWNHWIAFVLLIFLGGRMIIEGFRGADDEDEEPRRRHGFWLLVTTAIATSLDAM AVGVGLAFLQVNIIATALAIGCATLIMSTLGMMVGRFIGSIIGKKAEILGGLVLIGIGVQ ILWTHFHG

Protein Names:Recommended name: UPF0059 membrane protein yebN

Gene Names:Name:yebN Ordered Locus Names:ECIAI1_1891

Expression Region:1-188

Sequence Info:full length protein

View full details