Gene Bio Systems
Recombinant Escherichia coli O157:H7 Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnE(arnE)
Recombinant Escherichia coli O157:H7 Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnE(arnE)
SKU:CSB-CF469131EOE
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Escherichia coli O157:H7 (strain EC4115 / EHEC)
Uniprot NO.:B5YXQ1
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MIWLTLVFASLLSVAGQLCQKQATCFVAISKRRKHIVLWLGLALACLGLAMVLWLLVLQN VPVGIAYPMLSLNFVWVTLAAVKLWHEPVSPRHWCGVAFIIGGIVILGSTV
Protein Names:Recommended name: Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnE Short name= L-Ara4N-phosphoundecaprenol flippase subunit ArnE Alternative name(s): Undecaprenyl phosphate-aminoarabinose flippase subunit ArnE
Gene Names:Name:arnE Ordered Locus Names:ECH74115_3399
Expression Region:1-111
Sequence Info:full length protein