Skip to product information
1 of 1

GeneBio Systems

Recombinant Escherichia coli O157:H7 Enoyl-[acyl-carrier-protein] reductase [NADH] FabI (fabI)

Recombinant Escherichia coli O157:H7 Enoyl-[acyl-carrier-protein] reductase [NADH] FabI (fabI)

SKU:P0AEK5

Regular price €852,95 EUR
Regular price Sale price €852,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size: 100ug. Other sizes are also available.

Activity: Not tested

Research Areas: others

Uniprot ID: P0AEK5

Gene Names: fabI

Alternative Name(s): (ENR)(NADH-dependent enoyl-ACP reductase)

Abbreviation: Recombinant E.coli O157: H7 fabI protein

Organism: Escherichia coli O157: H7

Source: E.coli

Expression Region: 2-262aa

Protein Length: Full Length of Mature Protein

Tag Info: N-terminal 6xHis-tagged

Target Protein Sequence: GFLSGKRILVTGVASKLSIAYGIAQAMHREGAELAFTYQNDKLKGRVEEFAAQLGSDIVLQCDVAEDASIDTMFAELGKVWPKFDGFVHSIGFAPGDQLDGDYVNAVTREGFKIAHDISSYSFVAMAKACRSMLNPGSALLTLSYLGAERAIPNYNVMGLAKASLEANVRYMANAMGPEGVRVNAISAGPIRTLAASGIKDFRKMLAHCEAVTPIRRTVTIEDVGNSAAFLCSDLSAGISGEVVHVDGGFSIAAMNELELK

MW: 31.8 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Endotoxin: Not test

Biological_Activity:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Relevance: Catalyzes the reduction of a carbon-carbon double bond in an enoyl moiety that is covalently linked to an acyl carrier protein (ACP). Involved in the elongation cycle of fatty acid which are used in the lipid metabolism and in the biotin biosynthesis .

Reference: "Genome sequence of enterohaemorrhagic Escherichia coli O157: H7." Perna N.T., Plunkett G. III, Burland V., Mau B., Glasner J.D., Rose D.J., Mayhew G.F., Evans P.S., Gregor J., Kirkpatrick H.A., Posfai G., Hackett J., Klink S., Boutin A., Shao Y., Miller L., Grotbeck E.J., Davis N.W. Blattner F.R. Nature 409: 529-533(2001)

Function:

View full details