Skip to product information
1 of 1

Gene Bio Systems

Recombinant Escherichia coli O127:H6 Fumarate reductase subunit C(frdC)

Recombinant Escherichia coli O127:H6 Fumarate reductase subunit C(frdC)

SKU:CSB-CF485659EOB

Regular price €1.413,95 EUR
Regular price Sale price €1.413,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Escherichia coli O127:H6 (strain E2348/69 / EPEC)

Uniprot NO.:B7UPX4

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MTTKRKPYVRPMTSTWWKKLPFYRFYMLREGTAVPAVWFSIELIFGLFALKNGPEAWAGF VDFLQNPVIVIINLITLAAALLHTKTWFELAPKAANIIVKDEKMGPEPIIKSLWAVTVVA TIVILFVALYW

Protein Names:Recommended name: Fumarate reductase subunit C Alternative name(s): Fumarate reductase 15 kDa hydrophobic protein

Gene Names:Name:frdC Ordered Locus Names:E2348C_4480

Expression Region:1-131

Sequence Info:full length protein

View full details