Recombinant Escherichia coli Multidrug transporter emrE(emrE)

SKU: CSB-CF340580ENV

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Escherichia coli (strain K12)

Uniprot NO.:P23895

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MNPYIYLGGAILAEVIGTTLMKFSEGFTRLWPSVGTIICYCASFWLLAQTLAYIPTGIAY AIWSGVGIVLISLLSWGFFGQRLDLPAIIGMMLICAGVLIINLLSRSTPH

Protein Names:Recommended name: Multidrug transporter emrE Alternative name(s): Efflux-multidrug resistance protein emrE Ethidium resistance protein Methyl viologen resistance protein C

Gene Names:Name:emrE Synonyms:eb, mvrC Ordered Locus Names:b0543, JW0531

Expression Region:1-110

Sequence Info:full length protein