Skip to product information
1 of 1

Gene Bio Systems

Recombinant Escherichia coli Inner membrane protein ynbA(ynbA)

Recombinant Escherichia coli Inner membrane protein ynbA(ynbA)

SKU:CSB-CF304326ENV

Regular price €1.484,95 EUR
Regular price Sale price €1.484,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Escherichia coli (strain K12)

Uniprot NO.:P76090

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MTLYQIKPLFQSLLRPTMFWLYKHHVTANHITLAALALSLLTGLLLMLAAQPILFLLLPI VLFIRMALNALDGMLARECNQQTRLGAILNETGDVISDIALYLPFLFLPESNASLVILML FCTILTEFCGLLAQTINGVRSYAGPFGKSDRALIFGLWGLAVAIYPQWMQWNNLLWSIAS ILLLWTAINRCRSVLLMSAEI

Protein Names:Recommended name: Inner membrane protein ynbA

Gene Names:Name:ynbA Ordered Locus Names:b1408, JW1405

Expression Region:1-201

Sequence Info:full length protein

View full details