Skip to product information
1 of 1

Gene Bio Systems

Recombinant Escherichia coli Inner membrane protein ygjV(ygjV)

Recombinant Escherichia coli Inner membrane protein ygjV(ygjV)

SKU:CSB-CF331581ENV

Regular price €1.457,95 EUR
Regular price Sale price €1.457,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Escherichia coli (strain K12)

Uniprot NO.:P42603

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MTAYWLAQGVGVIAFLIGITTFFNRDERRFKKQLSVYSAVIGVHFFLLGTYPAGASAILN AIRTLITLRTRSLWVMAIFIVLTGGIGLAKFHHPVELLPVIGTIVSTWALFCCKGLTMRC VMWFSTCCWVIHNFWAGSIGGTMIEGSFLLMNGLNIIRFWRMQKRGIDPFKVEKTPSAVD ERG

Protein Names:Recommended name: Inner membrane protein ygjV

Gene Names:Name:ygjV Ordered Locus Names:b3090, JW3061

Expression Region:1-183

Sequence Info:full length protein

View full details