Skip to product information
1 of 1

Gene Bio Systems

Recombinant Escherichia coli Beta-lactamase CTX-M-1(bla)

Recombinant Escherichia coli Beta-lactamase CTX-M-1(bla)

SKU:CSB-EP333368ENL

Regular price €1.023,95 EUR
Regular price Sale price €1.023,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: Yes

Lead time: 3-7 working days

Research Topic: Others

Uniprot ID: P28585

Gene Names: bla

Organism: Escherichia coli

AA Sequence: QTADVQQKLAELERQSGGRLGVALINTADNSQILYRADERFAMCSTSKVMAVAAVLKKSESEPNLLNQRVEIKKSDLVNYNPIAEKHVDGTMSLAELSAAALQYSDNVAMNKLISHVGGPASVTAFARQLGDETFRLDRTEPTLNTAIPGDPRDTTSPRAMAQTLRNLTLGKALGDSQRAQLVTWMKGNTTGAASIQAGLPASWVVGDKTGSGDYGTTNDIAVIWPKDRAPLILVTYFTQPQPKAESRRDVLASAAKIVTNGL

Expression Region: 29-291aa

Sequence Info: Full Length

Source: E.coli

Tag Info: N-terminal 6xHis-tagged

MW: 32.2 kDa

Alternative Name(s): Beta-lactamase MEN-1Cefotaximase 1

Relevance: Broad spectrum beta-lactamase which confers resistance to penicillins, as well as first, second and third-generation cephalosporins.

Reference: Sequences of beta-lactamase genes encoding CTX-M-1 (MEN-1) and CTX-M-2 and relationship of their amino acid sequences with those of other beta-lactamases.Bauernfeind A., Stemplinger I., Jungwirth R., Casellas J.M.Antimicrob. Agents Chemother. 40:509-513(1996)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

View full details