Skip to product information
1 of 1

Gene Bio Systems

Recombinant Erwinia tasmaniensis UPF0059 membrane protein ETA_33770 (ETA_33770)

Recombinant Erwinia tasmaniensis UPF0059 membrane protein ETA_33770 (ETA_33770)

SKU:CSB-CF456967ENB

Regular price €1.467,95 EUR
Regular price Sale price €1.467,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Erwinia tasmaniensis (strain DSM 17950 / Et1/99)

Uniprot NO.:B2VCK3

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MNLYATLILAFAMSMDAFAAAICKGASLRRPTLKEALRTGLIFGVIEALTPLVGWAIGIA ASQYVMAWDHWVAFGLLFILGARMIVEGIRKKECSLEDAPSRHGFWLLACTAVATSLDAM AVGVGLAFLQVNIVTTALAIGASTMIMATMGILLGRFLGPVMGKWAEIFGGVVLIGIGSS ILVEHLGLLG

Protein Names:Recommended name: UPF0059 membrane protein ETA_33770

Gene Names:Ordered Locus Names:ETA_33770

Expression Region:1-190

Sequence Info:full length protein

View full details