Skip to product information
1 of 1

Gene Bio Systems

Recombinant Epstein-Barr virus Glycoprotein N(GN)

Recombinant Epstein-Barr virus Glycoprotein N(GN)

SKU:CSB-CF315172EFC

Regular price €1.344,95 EUR
Regular price Sale price €1.344,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Epstein-Barr virus (strain GD1) (HHV-4) (Human herpesvirus 4)

Uniprot NO.:P0C6Z4

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:SSPTNAAAASLTEAQDQFYSYTCNADTFSPSLTSFASIWALLTLVLVIIASAIYLMYVCF NKFVNTLLTD

Protein Names:Recommended name: Glycoprotein N Short name= gN

Gene Names:Name:GN ORF Names:BLRF1

Expression Region:33-102

Sequence Info:full length protein

View full details