Gene Bio Systems
Recombinant Enterobacter aerogenes Lipoprotein signal peptidase(lspA)
Recombinant Enterobacter aerogenes Lipoprotein signal peptidase(lspA)
SKU:CSB-CF320237EKO
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Enterobacter aerogenes (strain ATCC 13048 / DSM 30053 / JCM 1235 / KCTC 2190 / NBRC 13534 / NCIMB 10102 / NCTC 10006) (Aerobacter aerogenes)
Uniprot NO.:P13514
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MSKSICSTGLRWLWVVVAVLIIDLGSKFLILQNFALGETVSLFPSLNLHYARNYGAAFSF LADSGGWQRWFFAGIAVGICVVLAVLMYRSKATQKLNNIAYALIIGGALGNLFDRLWHGF VVDMIDFYVGDWHFATFNLADSAICIGAALIVLEGFLPSSDKKTS
Protein Names:Recommended name: Lipoprotein signal peptidase EC= 3.4.23.36 Alternative name(s): Prolipoprotein signal peptidase Signal peptidase II Short name= SPase II
Gene Names:Name:lspA Synonyms:lsp Ordered Locus Names:EAE_10850
Expression Region:1-165
Sequence Info:full length protein
