
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Elephas maximus (Indian elephant)
Uniprot NO.:Q2I3H1
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MAYPLQLGFQDATSPVMEELLHFHDHTLMIIFLISSLVLYIIMLMLTTKLIHTNMMNVQE MEMIWTILPAIILILIALPSLHTLYMMDEINNPLLTIKTMGHQWFWSYEYTDYEDLAFDS YMITTDSLKFGELRLLEVDNRMVLPTDLPVRVLVSSEDVLHSWAVPSLGLKTDAIPGRLN QVTLTSMRPGLFYGQCSEICGANHSFMPIVLELVPLKYFESWSASLA
Protein Names:Recommended name: Cytochrome c oxidase subunit 2 Alternative name(s): Cytochrome c oxidase polypeptide II
Gene Names:Name:MT-CO2 Synonyms:COII, COXII, MTCO2
Expression Region:1-227
Sequence Info:full length protein
You may also like
-
Recombinant Loxodonta africana Cytochrome c oxidase subunit 2(MT-CO2)
- Regular price
- €1.112,95 EUR
- Sale price
- €1.112,95 EUR
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Cuon alpinus Cytochrome c oxidase subunit 2(MT-CO2)
- Regular price
- €1.111,95 EUR
- Sale price
- €1.111,95 EUR
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Maxomys surifer Cytochrome c oxidase subunit 2(MT-CO2)
- Regular price
- €1.111,95 EUR
- Sale price
- €1.111,95 EUR
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Canis mesomelas elongae Cytochrome c oxidase subunit 2(MT-CO2)
- Regular price
- €1.111,95 EUR
- Sale price
- €1.111,95 EUR
- Regular price
-
- Unit price
- per
Sold out