Gene Bio Systems
Recombinant Drosophila sechellia Vacuolar ATPase assembly integral membrane protein VMA21 (GM22297)
Recombinant Drosophila sechellia Vacuolar ATPase assembly integral membrane protein VMA21 (GM22297)
SKU:CSB-CF025866DMG
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Drosophila sechellia (Fruit fly)
Uniprot NO.:B4IAB8
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MSTKNKKAAGGNGGAPKQTRQQSHDSQDYSSFKTVLFYCMLIVFLPVLTFFVLKGFVLDQ FLNISEVKVNIASAVGAVVALHIALGLYIYRAYFGAPGSKGSKTD
Protein Names:Recommended name: Vacuolar ATPase assembly integral membrane protein VMA21
Gene Names:ORF Names:GM22297
Expression Region:1-105
Sequence Info:full length protein
