Skip to product information
1 of 1

Gene Bio Systems

Recombinant Drosophila pseudoobscura pseudoobscura UPF0389 protein GA21628(GA21628)

Recombinant Drosophila pseudoobscura pseudoobscura UPF0389 protein GA21628(GA21628)

SKU:CSB-CF645869DME

Regular price €1.413,95 EUR
Regular price Sale price €1.413,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Drosophila pseudoobscura pseudoobscura (Fruit fly)

Uniprot NO.:Q29DG0

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MFNKSALIGSLLRRSFGTTNPLRQAIKNHQPNEMEKRFLVWSGKYKSQAEVPAFVSQDEM ERVRNKMRIRLANIMIALTVIGCGIMVYSGKQAAKRGESVSKMNLEWHKQFNELKPEGGA AAPASTK

Protein Names:Recommended name: UPF0389 protein GA21628

Gene Names:ORF Names:GA21628

Expression Region:1-127

Sequence Info:full length protein

View full details