Skip to product information
1 of 1

Gene Bio Systems

Recombinant Drosophila melanogaster UPF0466 protein CG17680, mitochondrial(CG17680)

Recombinant Drosophila melanogaster UPF0466 protein CG17680, mitochondrial(CG17680)

SKU:CSB-CF765957DLU

Regular price €1.346,95 EUR
Regular price Sale price €1.346,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Drosophila melanogaster (Fruit fly)

Uniprot NO.:Q7JX57

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:SSVYFRSGAIKPKPEEMPFGLLAIFCAVIPGLFVGATISKNVANFLEENDLFVPADDDDD ED

Protein Names:Recommended name: UPF0466 protein CG17680, mitochondrial

Gene Names:ORF Names:CG17680

Expression Region:36-97

Sequence Info:full length protein

View full details