Recombinant Drosophila melanogaster Tyrosine-protein kinase hopscotch (hop), partial

SKU: Q24592

Size: 100ug. Other sizes are also available.

Activity: Not tested

Research Areas: Others

Uniprot ID: Q24592

Gene Names: hop

Alternative Name(s):

Abbreviation: Recombinant Drosophila melanogaster hop protein, partial

Organism: Drosophila melanogaster (Fruit fly)

Source: E.coli

Expression Region: 582-843aa

Protein Length: Partial

Tag Info: N-terminal 6xHis-tagged and C-terminal 6xHis-tagged

Target Protein Sequence: YPDSISLSDDGMMFTMRGDWIQQSPVKDVSVTMKMLKSDGNFMEFFRLAQTWSLIQSPQFLKLYGLTLADPYTMVMEYSRYGPLNKFLHSMPNVTLHCLLDLMHGLVRGMHYLEDNKIIHNYIRCSNLYVTKYDPNSYVLDAKISDPGYPRPYRESDSPWIPVKYYRNLQAAKTDQFAQLWAFATTIYEIFSRCKEDLSTLRQEQLLRQKNLDGNILKMLDQDICPAPIFETIMDGWSDDETKRFSHHDIFSRLNTIKAEIL

MW: 40.7 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Endotoxin: Not test

Biological_Activity:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Relevance: Tyrosine kinase of the non-receptor type, phosphorylates the marelle protein. Required maternally for the establishment of the normal array of embryonic segments: involved in the control of pair-rule gene transcription in a stripe-specific manner. Together with Hsp83 and piwi, mediates canalization, also known as developmental robustness, likely via epigenetic silencing of existing genetic variants and suppression of transposon-induced new genetic variation.

Reference:

Function: