Skip to product information
1 of 1

Gene Bio Systems

Recombinant Drosophila melanogaster Cytochrome b5(Cyt-b5)

Recombinant Drosophila melanogaster Cytochrome b5(Cyt-b5)

SKU:CSB-CF894179DLU

Regular price €1.415,95 EUR
Regular price Sale price €1.415,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Drosophila melanogaster (Fruit fly)

Uniprot NO.:Q9V4N3

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MSSEETKTFTRAEVAKHNTNKDTWLLIHNNIYDVTAFLNEHPGGEEVLIEQAGKDATENF EDVGHSNDARDMMKKYKIGELVESERTSVAQKSEPTWSTEQQTEESSVKSWLVPLVLCLV ATLFYKFFFGGAKQ

Protein Names:Recommended name: Cytochrome b5 Short name= CYTB5

Gene Names:Name:Cyt-b5 ORF Names:CG2140

Expression Region:1-134

Sequence Info:full length protein

View full details