Gene Bio Systems
Recombinant Dog Chymase(CMA1)
Recombinant Dog Chymase(CMA1)
SKU:CSB-EP005599DO
Couldn't load pickup availability
Size: 200ug. Other sizes are also available. Please Inquire.
In Stock: No
Lead time: 10-20 working days
Research Topic: Others
Uniprot ID: P21842
Gene Names: CMA1
Organism: Canis lupus familiaris (Dog) (Canis familiaris)
AA Sequence: IIGGTESKPHSRPYMAHLEILTLRNHLASCGGFLIRRNFVLTAAHCAGRFIMVTLGAHNIQKKEDTWQKLEVIKQFPHPKYDDLTLRHDIMLLKLKEKANLTLAVGTLPLSPQFNFVPPGRMCRVAGWGKRQVNGSGSDTLQEVKLRLMDPQACRHYMAFDHNLQLCVGNPRKTKSAFKGDSGGPLLCAGVAQGIVSYGQNDAKPPAVFTRISHYRPWINKVLKQNKA
Expression Region: 22-249aa
Sequence Info: Full Length
Source: E.coli
Tag Info: N-terminal 6xHis-SUMO-tagged
MW: 41.5 kDa
Alternative Name(s): Alpha-chymase;Mast cell protease I
Relevance: Major secreted protease of mast cells with suspected roles in vasoactive peptide generation, Extracellular domain matrix degradation, and regulation of gland secretion.
Reference: Purification and characterization of dog mastocytoma chymase identification of an octapeptide conserved in chymotryptic leukocyte proteinases.Caughey G.H., Viro N.F., Lazarus S.C., Nadel J.A.Biochim. Biophys. Acta 952:142-149(1988)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer,50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
