Gene Bio Systems
Recombinant Dictyostelium discoideum Reactive oxygen species modulator 1 homolog(romo1)
Recombinant Dictyostelium discoideum Reactive oxygen species modulator 1 homolog(romo1)
SKU:CSB-CF703774DKK
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Dictyostelium discoideum (Slime mold)
Uniprot NO.:Q54M86
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MSYPKRYGQENNRVLGDANNQCIQSIKMGFLMGAGVGATFGSCIVLIMFAAKKLPRAILM KTLGSSAMKMGGMFGCFMGIGGALRCEVDETKINKNNKNNNNNNNNIHSFFKNSNTEYDI SKFNKTKF
Protein Names:Recommended name: Reactive oxygen species modulator 1 homolog Short name= ROS modulator 1 homolog Alternative name(s): Protein MGR2 homolog
Gene Names:Name:romo1 ORF Names:DDB_G0286181
Expression Region:1-128
Sequence Info:full length protein
