Gene Bio Systems
Recombinant Dictyostelium discoideum Fido domain-containing protein DDB_G0283145(DDB_G0283145)
Recombinant Dictyostelium discoideum Fido domain-containing protein DDB_G0283145(DDB_G0283145)
SKU:CSB-CF709813DKK
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Dictyostelium discoideum (Slime mold)
Uniprot NO.:Q54RJ6
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MKGIIVSDGVYREEDVFAGQRIFMTPELIEKTMLGLVQKYNQYRPTTKSSPYAVAAWLLH AFVSIHPFIDGNGRMGRILANLVLFSYGFPFPVPISADNDEYIKSLRLADRYYEKGRDTS HLALIILNSSHSIYKNYLSNLEL
Protein Names:Recommended name: Fido domain-containing protein DDB_G0283145
Gene Names:ORF Names:DDB_G0283145
Expression Region:1-143
Sequence Info:full length protein
