Skip to product information
1 of 1

Gene Bio Systems

Recombinant Dictyostelium discoideum Fido domain-containing protein DDB_G0283145(DDB_G0283145)

Recombinant Dictyostelium discoideum Fido domain-containing protein DDB_G0283145(DDB_G0283145)

SKU:CSB-CF709813DKK

Regular price €1.420,95 EUR
Regular price Sale price €1.420,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Dictyostelium discoideum (Slime mold)

Uniprot NO.:Q54RJ6

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MKGIIVSDGVYREEDVFAGQRIFMTPELIEKTMLGLVQKYNQYRPTTKSSPYAVAAWLLH AFVSIHPFIDGNGRMGRILANLVLFSYGFPFPVPISADNDEYIKSLRLADRYYEKGRDTS HLALIILNSSHSIYKNYLSNLEL

Protein Names:Recommended name: Fido domain-containing protein DDB_G0283145

Gene Names:ORF Names:DDB_G0283145

Expression Region:1-143

Sequence Info:full length protein

View full details