Gene Bio Systems
Recombinant Deinococcus radiodurans Glycerol-3-phosphate acyltransferase 2(plsY2)
Recombinant Deinococcus radiodurans Glycerol-3-phosphate acyltransferase 2(plsY2)
SKU:CSB-CF882700DJA
Couldn't load pickup availability
Size:50 ug. Other sizes are also available.
Product Type:Recombinant Protein
Species:Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422)
Uniprot NO.:Q9RS57
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MRAVVSLAVVFVLSYLLGSLVAGVLYSRGRGEDIRGRDLPGGSGTYRQYGKGAAAAVTLA DILKGAAAVGLALWLAPQALPLATALATFGVVFGHCYPVWFGFRGGGGIAPFLGAMLVVA PWTLLATVTFALALIPLYRATLQPRLRLNAIPFATVVAVPVGLLIASRLGGGAEFLAGSA AMGIRAVHLLAEQRA
Protein Names:Recommended name: Glycerol-3-phosphate acyltransferase 2 Alternative name(s): Acyl-PO4 G3P acyltransferase 2 Acyl-phosphate--glycerol-3-phosphate acyltransferase 2 G3P acyltransferase 2 Short name= GPAT 2 EC= 2.3.1.n3 Lys
Gene Names:Name:plsY2 Ordered Locus Names:DR_2270
Expression Region:1-195
Sequence Info:full length protein
