Skip to product information
1 of 1

Gene Bio Systems

Recombinant Danio rerio Succinate dehydrogenase [ubiquinone] cytochrome b small subunit B, mitochondrial(sdhdb)

Recombinant Danio rerio Succinate dehydrogenase [ubiquinone] cytochrome b small subunit B, mitochondrial(sdhdb)

SKU:CSB-CF734666DIL

Regular price €1.416,95 EUR
Regular price Sale price €1.416,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Danio rerio (Zebrafish) (Brachydanio rerio)

Uniprot NO.:Q68FN7

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:AVQQKDHDCSYLISARIHATPSNYAGSGSKAATMHWTGERILSIALLSLAPVAYFCPSPA VDYSLAAALTLHGHWGLGQVVTDYVHGDAKIKMANAGLFVLSTVTFAGLCYFNYHDVGIC KAVALLWSK

Protein Names:Recommended name: Succinate dehydrogenase [ubiquinone] cytochrome b small subunit B, mitochondrial Short name= CybS-B Alternative name(s): Succinate dehydrogenase complex subunit D-B Succinate-ubiquinone oxidoreductase cytochrome b smal

Gene Names:Name:sdhdb Synonyms:sdhd, sdhda ORF Names:zgc:100986

Expression Region:30-158

Sequence Info:full length protein

View full details