Skip to product information
1 of 1

Gene Bio Systems

Recombinant Danio rerio Ribonuclease kappa-B(rnasekb)

Recombinant Danio rerio Ribonuclease kappa-B(rnasekb)

SKU:CSB-CF612660DIL

Regular price €1.386,95 EUR
Regular price Sale price €1.386,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Danio rerio (Zebrafish) (Brachydanio rerio)

Uniprot NO.:Q0P442

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MPSLLFCGPKLAACGIVLSVWGVIMLSMLGIFFSAKSAVLIEDVPFTEEDIRNDKDPPQI IYGLYNQVGINCFIAAAIYVGVGAVSLCQVRLNKRQEYMVT

Protein Names:Recommended name: Ribonuclease kappa-B Short name= RNase K-B Short name= RNase kappa-B EC= 3.1.-.-

Gene Names:Name:rnasekb ORF Names:zgc:153424

Expression Region:1-101

Sequence Info:full length protein

View full details