Skip to product information
1 of 1

Gene Bio Systems

Recombinant Danio rerio Mpv17-like protein 2(mpv17l2)

Recombinant Danio rerio Mpv17-like protein 2(mpv17l2)

SKU:CSB-CF728529DIL

Regular price €1.482,95 EUR
Regular price Sale price €1.482,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Danio rerio (Zebrafish) (Brachydanio rerio)

Uniprot NO.:Q6DGV7

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MISRQGKEFLVRIAGYWKPLFRGRFLIVTNTVSCGGMLAAGDLIQQTREIRRTPGRTRDW SRTGCMFAVGCSMGPFMHYWYQWLDKYFIGNGINNVCKKVLVDQLVASPTLGAWYFLGMG MMEGHTFIEAQQEFRDKFWEFYKADWCVWPAAQMINFYFLPPKFRVLYVNIVTLGWDTYL SYLKHRDTVEVTKEADGTA

Protein Names:Recommended name: Mpv17-like protein 2

Gene Names:Name:mpv17l2 ORF Names:zgc:92754

Expression Region:1-199

Sequence Info:full length protein

View full details