Skip to product information
1 of 1

Gene Bio Systems

Recombinant Danio rerio Mitochondrial import inner membrane translocase subunit Tim23(timm23)

Recombinant Danio rerio Mitochondrial import inner membrane translocase subunit Tim23(timm23)

SKU:CSB-CF752609DIL

Regular price €1.329,95 EUR
Regular price Sale price €1.329,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Danio rerio (Zebrafish) (Brachydanio rerio)

Uniprot NO.:Q7T2P6

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MDNSTPPPGGFKGGLGSIFGGGTPEYSNTELSGVPLTGMSPLSPYLNVDPRYLIQDTDEF ILPTGANKTRGRFELAFFTIGGCCITGAAFGTLNGLRMGLSETRDMPWSKPRNVQILNMV TRQGASWANTLGSVALLYSVFGVAIEKARGAEDDLNTVAAGTLTGMVFKSTGGLKGVARG GLIGLAMSGLYALYNNWDHLKGKSPSHY

Protein Names:Recommended name: Mitochondrial import inner membrane translocase subunit Tim23

Gene Names:Name:timm23

Expression Region:1-208

Sequence Info:full length protein

View full details