Skip to product information
1 of 1

Gene Bio Systems

Recombinant Danio rerio Heme transporter hrg1-A(slc48a1b)

Recombinant Danio rerio Heme transporter hrg1-A(slc48a1b)

SKU:CSB-CF752613DIL

Regular price €1.427,95 EUR
Regular price Sale price €1.427,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Danio rerio (Zebrafish) (Brachydanio rerio)

Uniprot NO.:Q7T3B2

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MAFNKTYIRVGYSCMGMLVGFSAFLVWNIAYKQPWTAAMGGLSGVLALWALVTHIMYIQD YWRTWLKGLKFFMAMGVIFSVLSIVAFISFLCVAISRQQSLTDPTSLYLSCVWSFMSLKW SFLLTLYSHRYRKEFADISILNDF

Protein Names:Recommended name: Heme transporter hrg1-A Short name= zHRG-1 Alternative name(s): Heme-responsive gene 1 protein homolog A Short name= HRG-1A Solute carrier family 48 member 1-B

Gene Names:Name:slc48a1b Synonyms:hrg1a ORF Names:zgc:63994

Expression Region:1-144

Sequence Info:full length protein

View full details