Skip to product information
1 of 1

Gene Bio Systems

Recombinant Danio rerio Erlin-2(erlin2)

Recombinant Danio rerio Erlin-2(erlin2)

SKU:CSB-CF007791DIL

Regular price €1.615,95 EUR
Regular price Sale price €1.615,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Danio rerio (Zebrafish) (Brachydanio rerio)

Uniprot NO.:A3QK16

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MTLGAVASLILAIGGAAVFSALHKIEEGHVGVYYRGGALLTATSGPGFHLMLPFITTFKSVQTTLQTDEVKNVPCGTGGGVMIYFDRIEVVNYLVPSAVYGIVRNFTADYDKALIFNKVHHELNQFCSVHTLQDVYIGLFDQIDENLKLTLQEDLTSMAPGLIIQAVRVTKPNIPESIRRNYELMESERTKLLIAAQTQKVVEKEAETERKKAVIEAEKVAQVAEIKFGQKVMEKETEKKISQIEDSAYLARQKAKADAEFYSAQRAAEANKLKLTPEYLQLMKFKAIAANSKIYFGSEIPHMFMDSGPGSSSSAASKAIDVLSEGMLDLE

Protein Names:Recommended name: Erlin-2 Alternative name(s): Endoplasmic reticulum lipid raft-associated protein 2

Gene Names:Name:erlin2 ORF Names:si:dkey-204l11.2

Expression Region:1-331

Sequence Info:full length protein

View full details