Skip to product information
1 of 1

Gene Bio Systems

Recombinant Danio rerio E3 ubiquitin-protein ligase MARCH5(41338)

Recombinant Danio rerio E3 ubiquitin-protein ligase MARCH5(41338)

SKU:CSB-CF757535DIL

Regular price €1.573,95 EUR
Regular price Sale price €1.573,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Danio rerio (Zebrafish) (Brachydanio rerio)

Uniprot NO.:Q6NYK8

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MACVDEPPEKHCWVCFATEKEDRAAEWVSPCRCKGCTKWIHQSCLQRWLDEKQKGNSGGA VSCPQCGTEYRIVFPKMGPVVYFLQQVDRALSRASPFAAAGVVVGTVYWSAVTYGAVTVM QVVGHKKGLDVMERADPLFLLMGLPTIPVMLVLGKMIRWEDYVVRLWQRHSAKLQIFSGL VPGMGRALPRVPVEGSYGGDHLSVSRTLCGALIFPSIANLVGRLLFRRVTSNLQRTILGG IAFVVMKGVLKVYFKQQQYLIQANRHILNYPEPEGQADGATEDEDSSNE

Protein Names:Recommended name: E3 ubiquitin-protein ligase MARCH5 EC= 6.3.2.- Alternative name(s): Membrane-associated RING finger protein 5 Membrane-associated RING-CH protein V Short name= MARCH-V

Gene Names:Name:march5 Synonyms:march5l ORF Names:zgc:56713

Expression Region:1-289

Sequence Info:full length protein

View full details