Skip to product information
1 of 1

Gene Bio Systems

Recombinant Dactylis glomeRata Pollen allergen Dac g 3

Recombinant Dactylis glomeRata Pollen allergen Dac g 3

SKU:CSB-YP309006DAC

Regular price €1.001,95 EUR
Regular price Sale price €1.001,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 22-32 working days

Research Topic: Others

Uniprot ID: P93124

Gene Names: N/A

Organism: Dactylis glomerata (Orchard grass) (Cock's-foot grass)

AA Sequence: VKVTFKVEKGSDPKKLVLDIKYTRPGDTLAEVELRQHGSEEWEPLTKKGNLWEVKSSKPLTGPFNFRFMSKGGMRNVFDEVIPTAFKIGTTYTPEE

Expression Region: 1-96aa

Sequence Info: Full Length

Source: Yeast

Tag Info: N-terminal 6xHis-tagged

MW: 12.9 kDa

Alternative Name(s): Allergen Dac g III Allergen: Dac g 3

Relevance:

Reference: "Cloning, sequencing and immunological characterization of Dac g 3, a major allergen from Dactylis glomerata pollen."Guerin-Marchand C., Senechal H., Bouin A.P., Leduc-Brodard V., Taudou G., Weyer A., Peltre G., David B.Mol. Immunol. 33:797-806(1996)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

View full details