Gene Bio Systems
Recombinant Dactylis glomeRata Pollen allergen Dac g 3
Recombinant Dactylis glomeRata Pollen allergen Dac g 3
SKU:CSB-YP309006DAC
Couldn't load pickup availability
Size: 200ug. Other sizes are also available. Please Inquire.
In Stock: No
Lead time: 22-32 working days
Research Topic: Others
Uniprot ID: P93124
Gene Names: N/A
Organism: Dactylis glomerata (Orchard grass) (Cock's-foot grass)
AA Sequence: VKVTFKVEKGSDPKKLVLDIKYTRPGDTLAEVELRQHGSEEWEPLTKKGNLWEVKSSKPLTGPFNFRFMSKGGMRNVFDEVIPTAFKIGTTYTPEE
Expression Region: 1-96aa
Sequence Info: Full Length
Source: Yeast
Tag Info: N-terminal 6xHis-tagged
MW: 12.9 kDa
Alternative Name(s): Allergen Dac g III Allergen: Dac g 3
Relevance:
Reference: "Cloning, sequencing and immunological characterization of Dac g 3, a major allergen from Dactylis glomerata pollen."Guerin-Marchand C., Senechal H., Bouin A.P., Leduc-Brodard V., Taudou G., Weyer A., Peltre G., David B.Mol. Immunol. 33:797-806(1996)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer,50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
