Recombinant Dactylis glomeRata Major pollen allergen Dac g 4

SKU: CSB-YP307868DAC

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 22-32 working days

Research Topic: Others

Uniprot ID: P82946

Gene Names: N/A

Organism: Dactylis glomerata (Orchard grass) (Cock's-foot grass)

AA Sequence: DIYNYMEPYVSKVDPTDYFGNEQARTAWVDSGAQLGELSYGVLFNIQYVNYWFAP

Expression Region: 1-55aa

Sequence Info: Full Length

Source: Yeast

Tag Info: N-terminal 6xHis-tagged

MW: 8.4 kDa

Alternative Name(s): Allergen: Dac g 4

Relevance:

Reference: "Characterization of Dac g 4, a major basic allergen from Dactylis glomerata pollen."Leduc-Brodard V., Inacio F., Jaquinod M., Forest E., David B., Peltre G.J. Allergy Clin. Immunol. 98:1065-1072(1996)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer，50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.