Skip to product information
1 of 1

Gene Bio Systems

Recombinant D-methionine transport system permease protein metI(metI)

Recombinant D-methionine transport system permease protein metI(metI)

SKU:CSB-CF820732YAS-GB

Regular price €1.500,95 EUR
Regular price Sale price €1.500,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Yersinia pestis

Uniprot NO.:Q8ZH39

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MSEAMMWLMARGVWETLMMTFVSGFFGFVLGLPVGVLLYVTRPGQIIANNKIYRTLSGVV NIFRSIPFIILLVWMIPFTRMIVGTSIGLQAAIVPLTVGAAPFIARMVENALLEIPSGLV EAARAMGATPMQIIKKVLLPEALPGLVNAATITLITLVGYSAMGGAVGAGGLGQIGYQYG YIGYNATVMNTVLVLLVILVYLIQLSGDRIVKAVTHK

Protein Names:Recommended name: D-methionine transport system permease protein metI

Gene Names:Name:metI Ordered Locus Names:YPO1072, y3105, YP_2777

Expression Region:1-217

Sequence Info:full length protein

View full details