Skip to product information
1 of 1

Gene Bio Systems

Recombinant Cytophaga hutchinsonii NADH-quinone oxidoreductase subunit A(nuoA)

Recombinant Cytophaga hutchinsonii NADH-quinone oxidoreductase subunit A(nuoA)

SKU:CSB-CF604873CAAO

Regular price €1.253,95 EUR
Regular price Sale price €1.253,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Cytophaga hutchinsonii (strain ATCC 33406 / NCIMB 9469)

Uniprot NO.:Q11VB2

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MNNKYAEYLPIAIQLMVTLGFISVTLLSSWLLGPKVKSKKKLDAFESGLDPVGNARVQFS IKYFLVATLFVLFDVEVIFFYPWAVNFNYFAEAVNKWEGFVKMLLFMTSLLIGFIYVIKK KALDWE

Protein Names:Recommended name: NADH-quinone oxidoreductase subunit A EC= 1.6.99.5 Alternative name(s): NADH dehydrogenase I subunit A NDH-1 subunit A NUO1

Gene Names:Name:nuoA Ordered Locus Names:CHU_1382

Expression Region:1-126

Sequence Info:full length protein

View full details